Floral Inspired Aquamarine Rose Engagement Ring with Diamond

0
Sale price $1,129 Regular price $1,269
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Romantic Ring Inspired by Nature

This floral-inspired aquamarine rose engagement ring is designed for those who are drawn to soft, nature-led aesthetics. Its delicate composition reflects the beauty of blooming forms, offering a distinctive alternative to traditional engagement styles while maintaining a refined and graceful presence.

Ideal for individuals who prefer meaningful design over conventional minimalism, it brings a sense of individuality to everyday wear.

Floral Design with Sculptural Detail

The rose-inspired motif introduces depth and movement into the ring’s structure. Each curve contributes to a layered visual effect, creating a design that feels dimensional rather than flat. This approach allows the ring to stand out while still maintaining balance on the finger.

It offers a thoughtful interpretation of floral design, avoiding excessive ornamentation while preserving elegance.

Aquamarine Center with Diamond Accents

The aquamarine center stone introduces a calm and airy tone, providing a subtle yet noticeable presence. Its soft color pairs naturally with the surrounding diamond accents, which add brightness and contrast without overpowering the central focus.

This combination creates a harmonious look where color and sparkle are carefully balanced.

Stone Selection and Wear Consideration

Aquamarine is valued for its clarity and soothing hue, making it suitable for those seeking a lighter alternative to traditional center stones. Diamond accents contribute to overall brilliance while supporting the structure of the design.

With mindful handling and routine care, the ring can maintain its visual appeal over time.

Designed for Meaningful Everyday Wear

The ring’s design allows it to transition comfortably between daily wear and special occasions. Its organic form pairs well with both minimal and decorative jewelry, offering flexibility in styling.

It is crafted for those who want an engagement ring that feels personal, expressive, and timeless without relying on traditional design conventions.

Product Information
SKU SHP-RINGS0821183064
Width 5.4 mm
Height 8 mm
Weight 2.70 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-engagement-rings

Faq About: Floral Inspired Aquamarine Rose Engagement Ring with Diamond

Is a floral engagement ring suitable for everyday wear?
Floral engagement rings can be worn daily when handled with care, especially when designed with balanced proportions and secure settings.
What makes aquamarine a unique choice for engagement rings?
Aquamarine is known for its soft blue tone and clarity, offering a lighter and more distinctive alternative to traditional center stones.
Do diamond accents enhance the design of this ring?
Diamond accents add brightness and contrast, helping to highlight the center stone while enhancing the overall visual balance.
Is this ring suitable for someone looking for a non-traditional style?
Yes, the floral and sculptural design makes it a strong choice for those who prefer a unique engagement ring over classic styles.
Can this ring be paired with other bands?
It can be paired with complementary bands, though its sculptural design may influence how closely another band sits alongside it.
How should I care for this ring to maintain its appearance?
Regular gentle cleaning and safe storage can help preserve the ring’s shine and protect its detailed design over time.