Diamonds Infinity Eternity Pendant Necklace

0
Regular price $1,619
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Diamond Infinity Pendant Necklace

This diamond infinity eternity pendant necklace is designed for buyers who value symbolic jewelry with long-lasting relevance. The infinity motif represents continuity and connection, making the necklace suitable for meaningful gifting as well as personal everyday wear.

Its balanced proportions allow the pendant to sit naturally against the neckline, creating a refined look without appearing oversized or heavy. The design focuses on versatility, making it easy to pair with both casual and formal outfits.

Design & Setting

The infinity form is structured to maintain visual symmetry while securely holding the diamonds in place. The setting emphasizes clean lines and smooth edges to support comfort during extended wear, ensuring the necklace remains practical as well as visually appealing.

Diamond Use & Wearability

Diamonds are widely chosen for daily-wear jewelry due to their durability and ability to maintain appearance over time. When set correctly and cared for, they are suitable for regular use without compromising the overall design integrity.

High-Level Features

  • Infinity-inspired pendant design
  • Diamond-accented structure for lasting wear
  • Comfort-focused proportions
  • Symbolic style suitable for gifting
Product Information
SKU SHP-PENDANT022150090
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.57 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 62 Pieces
Total Weight 0.57 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-50 Pcs
Round-1X1 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Surfaced-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces
Is this necklace suitable for everyday wear?
Yes, the pendant is designed with balanced proportions and durable diamond settings, making it suitable for regular daily wear with proper care.
What does the infinity design represent?
The infinity symbol is commonly associated with continuity, connection, and lasting meaning, which makes it popular for personal and gift jewelry.
Are the diamonds secure in the setting?
The diamonds are placed in a structured setting designed to support stability during everyday movement.
What metal options are available?
All available metal options and specifications are listed in the product detail tables provided on this page.
How should this necklace be cared for?
Gentle cleaning and proper storage are recommended to help maintain the appearance and longevity of the necklace.