Diamond Leaf Flat Back Cartilage Stud Earring (18G) – Nature Inspired Helix & Tragus Jewelry in Gold

0
Regular price $1,109
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A delicate diamond leaf cartilage earring designed for a refined, nature-inspired ear stack.

This elegant diamond leaf cartilage earring features a graceful botanical silhouette crafted in solid gold and accented with sparkling round diamonds. Designed for modern piercing jewelry lovers, this piece is ideal for helix, tragus, cartilage, and upper lobe piercings. Whether chosen for everyday styling or as a meaningful gift, it combines fine jewelry craftsmanship with comfortable flat back wearability.

Diamond Leaf Flat Back Cartilage Stud: Nature-Inspired Design with Everyday Comfort

Inspired by the soft shape of leaves, this nature inspired diamond helix earring blends organic design with subtle brilliance. The clustered round diamonds are arranged across the leaf motif to create a balanced sparkle, while the slim profile makes it ideal for curated ear styling.

Its flat back construction offers a secure and comfortable fit, making it a practical choice for daily wear while maintaining the elegance of fine diamond jewelry.

What Makes This Diamond Cartilage Earring Special

  • Features 13 round diamonds arranged in a graceful leaf-inspired design
  • Designed as a flat back cartilage stud for comfort and secure wear
  • Crafted in solid gold for lasting beauty and premium feel
  • Set in a prong setting to enhance brilliance and visibility of each stone
  • Perfect as a diamond helix earring, tragus stud, or cartilage piercing jewelry

Why People Choose a Diamond Leaf Cartilage Earring

This style appeals to those who want more than a basic stud. A leaf design brings a sense of softness, growth, and individuality, while diamonds add a timeless fine jewelry touch.

Unlike ordinary cartilage studs, this piece offers:

  • A unique nature-inspired look for curated ear styling
  • The brilliance of real or lab-grown diamonds
  • A refined balance of minimalism and luxury

For many buyers, it becomes a signature jewelry piece that feels personal, elegant, and easy to wear every day.

How This Earring Is Used

Customers typically choose this piece as:

  • A diamond helix earring for a curated ear stack
  • A diamond tragus stud with a delicate botanical style
  • A flat back cartilage earring for everyday comfort
  • A nature inspired diamond piercing jewelry gift for her

Authenticity & Craftsmanship of This Diamond Leaf Earring

Each earring is crafted with close attention to detail:

  • Made using natural diamonds in HI color SI clarity or lab-grown diamond options, depending on selection
  • Carefully crafted in 10K, 14K, or 18K solid gold
  • Designed with an 18 gauge (1.2 mm) post for standard cartilage piercings
  • Includes a certificate of authenticity
  • Produced as a made-to-order piece for quality-focused finishing

Style and Wearability of This Flat Back Diamond Stud

This earring is designed for versatility and comfort:

  • Flat back design supports comfortable long wear
  • Lightweight profile makes it suitable for daily styling
  • Elegant enough to wear alone, yet subtle enough to stack with other earrings

Its refined size and soft leaf motif make it suitable for both everyday wear and special gifting moments.

Product Information
SKU SHP-BODYJ082410073
Length 8.2 mm
Width 5.5 mm
Height 1.6 mm
Weight 2.65 gm (Approximate)
Center Stone Weight 0.07 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-1 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings

FAQs : Diamond Leaf Flat Back Cartilage Stud Earring

Is this earring suitable for helix and tragus piercings?

Yes, this diamond leaf earring is designed for helix, tragus, cartilage, and upper lobe piercings, making it a versatile choice for curated ear styling.

Is this a flat back cartilage earring?

Yes, it features a flat back design that offers a secure fit and enhanced comfort for long wear compared to traditional earring backs.

What gauge is this diamond cartilage stud?

This earring comes with a 1.2 mm post, which is 18 gauge, a common size used for cartilage piercings.

Is this earring sold as a pair or a single piece?

This product is sold as a single earring, which makes it ideal for mixing, matching, and building a curated ear stack.

Can I wear this diamond leaf earring every day?

Yes, this earring is designed for everyday wear. Its flat back construction, compact size, and fine jewelry craftsmanship make it comfortable and practical for daily use.

What kind of diamonds are used in this earring?

This design is available with natural diamonds in HI color and SI clarity, and selected variants may also be offered in lab-grown diamonds depending on the option chosen.

Is this earring made in real gold?

Yes, this cartilage stud is crafted in solid gold and is available in multiple gold purities and finishes based on the selected variant.

Does this earring come with a certificate?

Yes, this diamond leaf cartilage earring includes a certificate of authenticity for added confidence in your purchase.