Diamond Aquarius Zodiac Earring for Helix Piercing

0
Sale price $521 Regular price $599
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed for the free-spirited Aquarius soul, this diamond zodiac earring brings celestial sparkle to a curated ear. Four round diamonds create a constellation-inspired trail, giving the piece a starry crawler look that feels personal, expressive, and easy to style. Sold singly, it is a thoughtful choice for an Aquarius birthday, zodiac jewelry gift, new piercing celebration, or a self-gift that reflects individuality and cosmic charm.

Diamond Helix Piercing for Aquarius Zodiac Earring

This Aquarius zodiac earring is crafted with four round diamonds in a prong setting, creating an approximate total diamond weight of 0.19 carat. Each diamond measures approximately 2 x 2 mm, adding a bright constellation-like accent to helix, cartilage, or upper lobe styling. With lab diamond EF-VS and natural diamond HI-SI gemstone quality options, flat back post lengths, and multiple gold choices, it brings a refined astrological touch to modern body jewelry.

What Makes This Special

The design features four round diamonds with an approximate total stone weight of 0.19 carat. Each diamond measures approximately 2 x 2 mm, creating a clean celestial arrangement with enough sparkle to stand out in a curated ear stack.

The diamonds are round in shape, brilliant cut, HI in color, SI in quality grade, and secured in prong settings. The crawler design is made to ascend the ear, giving the Aquarius constellation-inspired motif a graceful, starry direction.

The earring has an approximate metal weight of 0.90 gm and is sold singly. Metal options include 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, with left ear and right ear selections available.

Why Choose This Design

Zodiac jewelry feels personal because it connects style with identity. This Aquarius earring gives that meaning a refined diamond finish, making it more expressive than a simple stud while still staying minimal enough for regular wear.

The prong setting keeps each diamond visually open, allowing the round stones to catch light like small stars along the ear. The flat back post options support comfortable placement for helix, cartilage, and upper lobe piercings, while the single-piece format makes it ideal for asymmetric styling or building a curated ear with intention.

Design Meaning

Aquarius is often associated with independence, originality, vision, and an open-minded spirit. In this diamond zodiac earring, the constellation-inspired crawler becomes a small symbol of self-expression and cosmic identity. It is especially meaningful for someone born under Aquarius or anyone drawn to celestial jewelry that feels personal, modern, and quietly powerful.

Authenticity & Craftsmanship

Each earring is carefully crafted with attention to diamond placement, prong setting security, smooth flat back finishing, and comfortable proportions. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for styling or gifting. For lasting care, store it separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This Aquarius diamond earring adds a refined celestial accent to helix, cartilage, and upper lobe piercings. Worn alone, it creates a clean zodiac statement; paired with tiny star studs, moon motifs, gold hoops, or diamond flat backs, it helps build a curated ear with a cosmic theme. Its gold options make it easy to match with warm or cool jewelry stacks, while the flat back design supports comfortable everyday styling.

Product Information
SKU SHP-BODYJ052310098
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.19 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-2X2 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Aquarius Zodiac Earring for Helix Piercing

What makes this Aquarius zodiac earring a meaningful gift?

The earring is inspired by the Aquarius zodiac sign, making it a personal gift for Aquarius birthdays, astrology lovers, or anyone who connects with celestial jewelry. Its diamond constellation-style design adds a refined sparkle to the meaning.

How many diamonds are used in this Aquarius earring?

The earring includes four round diamonds with an approximate total weight of 0.19 carat. Each diamond measures approximately 2 x 2 mm.

What cut and setting style are used for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are secured in prong settings, which help keep the stones visible and define the constellation-inspired crawler design.

Is this earring suitable for helix and cartilage piercings?

Yes. The earring is designed for helix, cartilage, and upper lobe piercings. Its crawler shape ascends the ear, while the flat back post length options help support a comfortable fit.

Is this earring sold as a single piece or a pair?

This earring is sold singly. Left ear and right ear selections are available, allowing buyers to style one side intentionally or create an asymmetric zodiac-inspired ear stack.

What metal options are available for this zodiac earring?

This design is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, giving buyers warm and cool precious metal choices for their piercing stack.

How should I care for this diamond Aquarius helix earring?

Store the earring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry it carefully before storing.