Cute Diamond Penguin Earring for Cartilage Piercing

0
Sale price $452 Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

You will achieve a playful look when you wear this Diamond Penguin Earring. Fashioned in hallmarked metal, making it a durable choice. It features dainty Round Shape Diamonds embellished on the body of a penguin motif, perfect to elevate your look. When paired with your favorite outfits, this Penguin Helix Earring will create incredible looks. Its a flawless piece to adorn any part of your ear. You can gift this Diamond Cartilage Earring to someone you love, like your daughter, mom, friend, girlfriend, or wife, as a New Years, Birthday, Anniversary, or Christmas Gift. This little Penguin Stud brings a charming vibe that is both playful and elegant. Whether you are dressing up for a special occasion or adding a touch of shine to your everyday outfit, it is a piece that instantly lifts your style. This Ear Piercing Earring comes in a pretty box, ready to gift or keep safe.

Product Information
SKU SHP-BODYJ082410114
Length 9 mm
Width 5.5 mm
Height 1.5 mm
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.31 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 52 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-6 Pcs
Round-0.90X0.90 mm-14 Pcs
Round-1.20X1.20 mm-6 Pcs
Round-1X1 mm-26 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More