Cultured 3 Carat Freshwater Pearl Solitaire Engagement Ring with Diamond

0
Sale price $996 Regular price $1,119
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Timeless in its charm and softly radiant in its beauty, this Pearl Engagement Ring captures a love story that grows with grace. At the center rests a luminous 7 mm Freshwater Pearl, long treasured as a symbol of purity, wisdom and new beginnings, making this Solitaire Engagement Ring a meaningful choice for a promise that lasts forever. Surrounding its gentle glow, dainty Diamond stones shimmer along a graceful Leaf motif, adding a touch of nature-inspired elegance. The leaf design carries its own symbolism, representing growth, renewal and a journey that continues to flourish with time. This Pearl Diamond Engagement Ring speaks of love that evolves, deepens and remains strong through every season. Perfect as an engagement ring or a heartfelt gift to mark a special moment, this Freshwater Pearl Ring reflects devotion in a way that is both subtle and unforgettable. Crafted with attention to detail and designed for everyday elegance, it is available in a variety of ring sizes to suit your preference. Presented in a signature jewelry box, this ring is a lasting symbol of love, growth and a beautiful future shared together.

Product Information
SKU SHP-RINGS072210057
Metal Weight 2.00 gm (Approximate)
Center Stone Weight 3.00 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 3.00 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.11 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-2 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1X1 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
pearl-engagement-rings