Created Blue Sapphire Snowflake Stud Earrings with Moissanite

0
Regular price $869
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a touch of winter magic to any look with these enchanting Snowflake Stud Earrings, designed to captivate with their delicate sparkle and timeless charm. Embellished with a brilliant round shaped lab created blue sapphire and surrounded by an intricate snowflake pattern adorned with shimmering round moissanites. Crafted with AAAA quality lab created blue sapphire and D-VS1 quality moissanites, these Winter Earrings offer an opulent appeal while remaining beautifully refined. The carefully crafted snowflake motif adds a whimsical yet sophisticated touch, making these Sapphire and Moissanite Earrings a delightful choice for both everyday wear and special occasions. Whether paired with casual outfits or more formal attire, their unique design ensures they stand out in every setting. Designed with comfort and security in mind, the screw back closure keeps the Blue Sapphire Earrings firmly in place, allowing for worry-free wear throughout the day.

Product Information
SKU SHP-EARRINGS012148212
Length 9.2 mm
Width 8.5 mm
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.25 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-2X2 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 24 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-12 Pcs
Round-1.30X1.30 mm-12 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
stud-earrings