Certified Ruby and Diamond Leaf Branch Promise Ring

0
Sale price $873 Regular price $959
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Inspired by the quiet beauty of a growing branch, this ruby and diamond promise ring brings romance into a delicate nature-led design. A round red ruby sits at the heart of the ring, framed by a beaded leaf branch motif that gives the piece a graceful, organic feel. Small round diamonds add a soft touch of sparkle, making the design meaningful for a promise, anniversary, birthday, or a heartfelt gift for someone who values jewelry with sentiment and symbolism.

Certified Ruby and Diamond Leaf Branch Promise Ring

This promise ring features one round brilliant cut ruby measuring approximately 3X3 mm and weighing approximately 0.13 carat. The ruby has a red color, AAA quality grade, and is secured in a prong setting. Six round brilliant diamonds, measuring approximately 0.90X0.90 mm each, add approximately 0.02 carat of accent sparkle with HI color and SI quality grade. With an approximate width of 2.9 mm, height of 3.7 mm, and weight of 1.10 grams, the ring offers a fine, feminine profile. Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

What Makes This Special

The design stands out through its leaf branch styling, where the ruby becomes the emotional focal point of a nature-inspired form. The beaded leaf detail adds texture and softness, giving the ring a more personal character than a plain promise ring.

The round ruby brings a vivid red center to the design, while the six small diamonds add subtle flashes of light around the branch-inspired setting. The combination of red gemstone color and diamond accents creates a thoughtful balance of warmth and sparkle.

Both the ruby and diamonds are set in prong settings, allowing the stones to remain visible while supporting a refined, delicate appearance on the finger.

Why Choose This Design

A ruby promise ring carries strong emotional appeal because ruby is closely associated with love, passion, and devotion. In this design, the red gemstone gives the ring a heartfelt center, while the leaf branch motif adds a sense of growth, care, and connection.

The ring’s slim structure makes it easy to wear, yet the 3.7 mm height gives the design enough presence to feel special. Diamond accents bring brightness without overpowering the ruby, making the ring suitable for someone who prefers meaningful color with a gentle sparkle. The available silver and gold metal options allow the same design to feel either bright, warm, or classic depending on the wearer’s style.

Design Meaning

The leaf branch design symbolizes growth, renewal, and a relationship that continues to deepen over time. Paired with a red ruby, the ring becomes a meaningful expression of affection and devotion. The diamonds add light to the branch-inspired form, creating a feeling of hope and celebration. As a promise ring, it speaks to love that is still growing, carefully nurtured, and chosen with intention.

Authenticity & Craftsmanship

Rosec Jewels crafts this ruby and diamond ring with careful attention to stone placement, secure prong settings, beaded leaf detail, and refined finishing. The product is offered as certified jewelry and includes a Certificate of Authenticity for added purchase confidence. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. To care for the ring, store it separately, avoid harsh chemicals, and clean it gently with a soft cloth to help protect the ruby, diamond accents, and metal finish.

Style and Wearability

The leaf branch shape gives the ring a soft, nature-inspired look from the top view, while the round ruby adds a distinct red focal point. Its fine proportions make it comfortable for regular styling with proper care, and it can be worn alone as a meaningful promise ring or paired with simple bands for a more personalized look. White metal options create a crisp contrast with the ruby, while yellow gold adds warmth to the red gemstone and beaded branch detail.

Product Information
SKU SHP-RINGS0821185381
Width 2.9 mm
Height 3.7 mm
Weight 1.10 gm (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-rings

FAQs About: Certified Ruby and Diamond Leaf Branch Promise Ring

What makes this ruby ring suitable as a promise ring?

The ring combines a red ruby, a gemstone associated with love and devotion, with a leaf branch design that symbolizes growth and connection. Its delicate diamond accents make it a meaningful choice for a promise, anniversary, birthday, or romantic gift.

What ruby details are used in this ring?

The ring features one round ruby measuring approximately 3X3 mm and weighing approximately 0.13 carat. The ruby has a brilliant cut, red color, AAA quality grade, and is secured in a prong setting.

Does this promise ring include diamonds?

Yes, the design includes six round brilliant diamonds measuring approximately 0.90X0.90 mm each. The diamonds have a combined approximate weight of 0.02 carat, with HI color and SI quality grade.

What does the leaf branch design symbolize?

The leaf branch design symbolizes growth, renewal, and a bond that continues to strengthen over time. Paired with the red ruby center, it creates a romantic meaning suited to commitment, affection, and personal milestones.

Which metal options are available for this ruby diamond ring?

The ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These choices allow the ruby and diamond design to be styled in either white or yellow metal tones.

Does this ring come with authenticity assurance?

Rosec Jewels offers this product as certified jewelry and includes a Certificate of Authenticity. The ring also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this ruby and diamond promise ring?

Store the ring separately, clean it gently with a soft cloth, and avoid harsh chemicals or abrasive contact. Removing it during heavy work, swimming, or cleaning can help protect the ruby, diamond accents, prong settings, and metal finish.