Certified Round Cut Moissanite Snowflakes Necklace for Women

0
Regular price $1,029
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Moissanite Snowflake Necklace

This necklace features a snowflake inspired pendant set with round cut moissanite stones arranged to form a delicate symmetrical pattern. The snowflake motif creates a visually intricate design while maintaining a light and elegant appearance.

The arrangement of gemstones within the pendant produces balanced sparkle, allowing the necklace to reflect light from multiple angles while preserving the refined structure of the design.

Snowflake Inspired Pendant Design

Snowflake jewelry designs are recognized for their symmetrical structure and intricate detailing. The pattern is inspired by the natural geometry of snowflakes, where multiple branches extend outward in a balanced formation.

This structure creates a decorative pendant that combines visual complexity with delicate styling, making it a distinctive addition to gemstone jewelry collections.

Round Cut Moissanite Stones

The necklace features round cut moissanite stones arranged throughout the snowflake pattern. Round cuts are commonly used in jewelry because their symmetrical structure reflects light evenly across the stone.

Moissanite used in jewelry is created without traditional mining, although environmental impact can vary depending on production processes and energy sources.

Balanced Pendant Composition

The gemstone arrangement and snowflake structure work together to create a pendant that balances decorative detail with brilliance. Each stone contributes to the overall light reflection while maintaining the symmetrical design of the motif.

This combination results in a necklace that emphasizes both geometric structure and gemstone sparkle.

Product Information
SKU SHP-PENDANT032013857
Length 15.7 mm
Width 9.9 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.85 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 19 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Round-2X2 mm-6 Pcs
Round-1.70X1.70 mm-12 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Certified Round Cut Moissanite Snowflakes Necklace for Women

What is a snowflake necklace design?
A snowflake necklace features a pendant design inspired by the symmetrical structure of natural snowflakes, often formed with gemstones arranged in a branching pattern.
What is moissanite used for in jewelry?
Moissanite is used in jewelry for its strong brilliance and reflective properties that enhance gemstone designs.
Why are round cut gemstones popular?
Round cut gemstones are popular because their symmetrical shape reflects light evenly, enhancing the overall brilliance of the stone.
What makes pendant necklaces popular?
Pendant necklaces are popular because they highlight a central design element while remaining versatile for everyday and special occasion wear.
Are gemstone necklaces suitable for everyday wear?
Gemstone necklaces are commonly worn daily because their designs can combine decorative elements with a compact pendant structure.
Why choose a moissanite necklace?
Moissanite necklaces are chosen for their brilliance and their ability to create bright gemstone designs with strong light reflection.