Certified Natural Citrine Diamond Drop Earrings with Fish Hook

0
Regular price $669
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add more charm and elegance to your look with these Citrine Drop Earrings, a graceful blend of warm hue and delicate sparkle. Each earring features a 5 mm Round Shape Citrine drop that glows with a golden hue, instantly brightening your style with its sunny charm. Just above the dainty Diamond is a petite leaf motif, adding a feminine touch that makes the design feel both fresh and sophisticated. The gentle movement of the Fish Hook allows these Citrine Diamond Earrings to sway lightly, catching light beautifully with every step you take. Perfect for both casual days and special evenings, these Citrine Earrings pair effortlessly with casual or formal outfits, making them a truly versatile addition to any jewelry collection. Presented in a signature jewelry box, these November Birthstone Earrings arrive ready to gift and are ideal for birthdays, anniversaries, holidays or simply surprising someone you love. Whether you are dressing up for an outing or adding a touch of warmth to your everyday look, these Yellow Citrine Earrings bring a charming sparkle that feels timeless and beautifully unique.

Product Information
SKU SHP-EARRINGS112115460
Length 19 mm
Width 5.7 mm
Height 3.4 mm
Metal Weight 1.04 gm (Approximate)
Total Stone Weight 1.09 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 2 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More