Certified Moissanite Vintage Inspired Key Pendant Necklace

0
Regular price $1,739
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Design with Vintage Character

The 1/4 Ct Certified Moissanite Vintage Gold Key Pendant Necklace blends symbolic meaning with refined detailing. Inspired by classic key motifs, this pendant represents new beginnings, opportunity, and personal milestones, making it a thoughtful gift or personal keepsake.

Its vintage influence is reflected in the delicate structure and carefully balanced proportions, offering a graceful presence without appearing heavy or ornate.

Detailed Craftsmanship and Setting

The key silhouette is thoughtfully crafted to maintain definition while allowing the moissanite accents to enhance its overall brilliance. The placement of the stones is designed to complement the vintage-inspired framework without overwhelming the design.

The pendant is structured to hang smoothly from the chain, creating natural movement and subtle light reflection when worn.

Certified Moissanite Value

Moissanite is chosen for its durability and strong light performance, making it suitable for regular wear. As a gemstone created without traditional mining, it offers an alternative to earth-mined stones, though environmental impact varies by production and energy source.

Certification provides additional confidence in the stone’s quality characteristics as detailed in the product specification tables.

High-Level Features

  • Vintage-inspired key pendant with symbolic appeal.
  • Certified moissanite center detailing.
  • Designed for balanced everyday wear.
  • Available in the metal options listed in the product detail tables.
Product Information
SKU SHP-PENDANT032213935
Weight 4.16 gm (Approximate)
Center Stone Weight 0.24 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-4 Pcs
Round-1.70X1.70 mm-2 Pcs
Round-2.20X2.20 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
key-necklaces

FAQs about: 1/4 Ct Certified Moissanite Vintage Gold Key Pendant Necklace

Is this key pendant suitable for daily wear?
Yes. Moissanite is known for its durability, and the structured design supports comfortable everyday wear when handled with standard jewelry care.
What does the key design symbolize?
A key motif often represents opportunity, love, milestones, or new beginnings, making it a meaningful choice for gifting or personal wear.
Does the pendant come with certification?
The moissanite included with this necklace is certified, as specified in the product detail tables, providing documented quality information.
How should I care for this necklace?
Clean gently with warm water, mild soap, and a soft brush. Store separately to prevent scratches and avoid exposure to harsh chemicals.
Is this necklace appropriate as a gift?
The symbolic key design and classic aesthetic make it suitable for occasions such as anniversaries, birthdays, or personal milestone celebrations.