Certified Moissanite Ocean Wave Necklace with Silver Chain

0
Sale price $120 Regular price $150
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Like a gentle ocean wave frozen in time, this Moissanite Pendant Necklace brings calm beauty and radiant sparkle to your jewelry collection. Inspired by the graceful movement of tranquil waves, this Moissanite Designer Pendant is a beautiful blend of elegance and modern design. Carefully crafted with 14K white gold plated silver, it showcases a smooth circular frame with a flowing wave pattern that symbolizes peace, balance, and natural beauty. At the center of the design sits a brilliant 8 MM round shaped moissanite, securely held in prong setting. The center stone shines with exceptional fire and brilliance, reflecting light from every angle. With its D-VS1 quality, the moissanite offers a bright sparkle that rivals traditional gemstones, giving the Ocean Wave Necklace a luxurious and eye-catching finish. The flowing wave motif is further enhanced with tiny shimmering stones that are carefully studded along the curved design. The circular frame surrounding the wave adds a modern touch while keeping the overall design timeless. This 2 carat Moissanite Necklace comes with a sturdy cable chain that allows it to sit comfortably and beautifully on the neckline. The chain supports the pendant perfectly, letting it move gently and catch the light as you wear it. Perfect for both everyday wear and special occasions, it easily complements a variety of outfits.

Product Information
SKU RCPE082410153-FBA
Weight 4.20 gm (Approximate)
Center Stone Weight 2.10 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 93 Pieces
Total Weight 3.06 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-9 Pcs
Round-0.90X0.90 mm-9 Pcs
Round-1.05X1.05 mm-13 Pcs
Round-1.10X1.10 mm-28 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.30X1.30 mm-19 Pcs
Round-1.40X1.40 mm-9 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More