Certified Moissanite Designer Infinity Necklace With Chain

0
Regular price $1,389
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Rosec Jewels stunning Infinity Pendant Necklace is a graceful blend of elegance, meaning, and modern design. Crafted as a true statement piece, the Designer Pendant features a beautiful infinity symbol that represents eternal love, connection, and timeless style. Delicately shaped within the design is a floral motif, adding a feminine touch that enhances its artistic appeal. The Statement Necklace for Women is embellished with sparkling round and pear shaped moissanites, each carefully secured in prong setting to maximize brilliance and shine. The D-VS1 quality moissanite fire and clarity bring a radiant glow that rivals fine diamonds, making this piece perfect for special occasions. Hanging elegantly from a cable chain, the Moissanite Necklace sits beautifully on the neckline and pairs effortlessly with both formal and fashionable looks. Its bold design makes it ideal as a cocktail or designer-style necklace, perfect for parties, celebrations, and elegant evenings. This Moissanite Infinity Necklace makes a meaningful and memorable gift for her, especially for birthdays, anniversaries, or milestone moments.

Product Information
SKU SHP-PENDANT042169823
Metal Weight 3.70 gm (Approximate)
Total Stone Weight 1.39 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 47 Pieces
Total Weight 1.39 Carat (Approximate)
Dimension(approx) Pear-2.00X3.50 mm-11 Pcs
Pear-4X6 mm-1 Pcs
Round-0.80X0.80 mm-1 Pcs
Round-0.90X0.90 mm-10 Pcs
Round-1.10X1.10 mm-15 Pcs
Round-1X1 mm-8 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-necklaces