Certified Moissanite Aries Zodiac Disc Pendant

0
Sale price $373 Regular price $429
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Symbolic Design with Personal Meaning

This Aries zodiac disc pendant is created for those who value jewelry with personal significance. The disc design offers a clean and timeless base, while the Aries symbol adds a meaningful element tied to identity and individuality.

Its balanced form makes it suitable for both everyday wear and thoughtful gifting.

Minimal Disc with Zodiac Detailing

The disc pendant provides a smooth and structured surface that highlights the engraved or detailed Aries motif. This design allows the symbol to remain the focal point without unnecessary embellishment.

The overall composition reflects a modern approach to zodiac-inspired jewelry.

Moissanite Accents with Subtle Brilliance

Moissanite is known for its bright and reflective appearance, adding a refined sparkle to the pendant. It is created without traditional mining, and its impact varies by production and energy source.

The stone enhances the design without overshadowing the symbolic detail of the piece.

Designed for Everyday Wear

The pendant is crafted for comfortable and regular use, with a lightweight structure that sits naturally when worn. Its minimal profile allows it to pair easily with different outfits and styles.

It can be worn alone for a clean look or layered with other necklaces for added dimension.

Product Information
SKU SHP-PENDANT042210270
Weight 4.64 gm (Approximate)
Center Stone Weight 0.94 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 64 Pieces
Total Weight 0.94 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-64 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1

View More

Product Parent Collection Handle
aries-zodiac-sign-jewelry

FAQs About: Moissanite Aries Zodiac Disc Pendant

What does the Aries zodiac symbol represent?
Aries is often associated with qualities such as confidence, energy, and leadership.
Is moissanite a durable stone?
Yes, moissanite is suitable for regular wear due to its durability and resistance to scratches.
Can this pendant be worn daily?
Yes, its lightweight and minimal design make it suitable for everyday use.
Is this pendant suitable for layering?
Yes, the simple disc design makes it easy to pair with other necklaces.
Is this a good gift option?
Yes, zodiac jewelry is often chosen as a meaningful and personalized gift.
How should I care for this pendant?
Clean gently with a soft cloth and avoid exposure to harsh chemicals to maintain its shine.