Certified Lab Grown Diamond Flower Stud Earrings With Screw Back

0
Sale price $947 Regular price $1,089
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Floral Stud Design with Defined Symmetry

These certified lab grown diamond flower stud earrings are crafted to reflect balanced floral symmetry in a compact stud silhouette. The petal-inspired arrangement frames the center with consistent brilliance, creating a structured yet delicate appearance on the ear.

The stud format allows the floral motif to sit neatly on the earlobe, making it suitable for both daily wear and occasion styling.

Screw Back Closure for Secure Placement

The screw back mechanism is designed to provide a reliable and stable fit. The threaded closure helps reduce movement and supports comfortable long-term wear compared to traditional friction backs.

This added security makes the earrings suitable for consistent use while maintaining a refined and understated profile.

Lab Grown Diamond Quality

Lab grown diamonds share the same physical, chemical, and optical properties as mined diamonds. Their hardness and durability make them appropriate for everyday stud earrings.

They are created without traditional mining, though environmental impact varies by production and energy source.

High-Level Features

This certified pair features lab grown diamonds arranged in a floral pattern and secured with screw back closures. The design emphasizes structured sparkle, balanced proportions, and dependable wear.

Product Information
SKU SHP-EARRINGS012410117
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 1.11 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 1.11 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Round-1.20X1.20 mm-24 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Diamond Flower Stud Earrings with Screw Back

What does certification confirm for these earrings?
Certification verifies the characteristics and origin of the lab grown diamonds, providing documented details about the stones used in the earrings.
Are screw back studs comfortable for extended wear?
Screw back closures are designed to stay securely fastened while maintaining a stable fit, which many wearers find suitable for extended daily use.
Do lab grown diamonds differ visually from natural diamonds?
Lab grown diamonds have the same visual and structural properties as natural diamonds and are not distinguishable to the unaided eye.
Is the floral design suitable for formal occasions?
The structured flower motif offers a refined appearance that can complement both everyday outfits and more formal attire.
How should these earrings be maintained?
Routine cleaning and periodic inspection of the screw back and settings help maintain brilliance and ensure continued secure wear.