Certified Lab Grown Diamond Flower Earrings With Screw Back

0
Regular price $979
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Floral Elegance in a Refined Stud

The certified lab grown diamond flower earrings with screw back are designed for those who prefer a delicate yet structured look. The floral silhouette offers soft symmetry, making these studs suitable for daily wear, professional settings, or meaningful gifting. Their balanced proportions allow them to sit neatly on the ear without appearing overstated.

Flower-Inspired Design & Secure Setting

Each earring is arranged in a flower motif, where the diamonds form petal-like accents around a central focal point. This composition enhances light reflection while maintaining a cohesive outline. The screw-back closure is crafted to provide added security, helping the earrings remain comfortably in place throughout the day.

Lab Grown Diamond Characteristics

Crafted with certified lab grown diamonds, these earrings deliver brilliance and durability suited for regular wear. Lab grown diamonds are created without traditional mining, though impact varies by production and energy source. They share the same physical properties as natural diamonds, making them a practical option for everyday fine jewelry.

High-Level Features

  • Floral-inspired diamond arrangement for a timeless silhouette.
  • Certified lab grown diamonds for consistent brilliance.
  • Screw-back closures for enhanced security and comfort.
  • Available in multiple precious metal options.
Product Information
SKU SHP-EARRINGS062510043
Length 6.1 mm
Width 6.4 mm
Height 3.4 mm
Metal Weight 2.07 gm (Approximate)
Total Stone Weight 0.48 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-8 Pcs
Color E-F
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Diamond Flower Earrings With Screw Back

Are these earrings made with certified lab grown diamonds?
Yes. The product details specify certified lab grown diamonds. Please refer to the product specification tables for complete grading information.
Do these earrings have secure backings?
Yes. They are crafted with screw-back closures designed to provide a secure and reliable fit.
Are lab grown diamonds suitable for everyday wear?
Lab grown diamonds have the same physical properties as natural diamonds and are suitable for regular wear when properly cared for.
What metal options are available?
Available metal choices are shown in the product selection area and detailed in the product specification tables on the page.
How should I care for these earrings?
Clean gently with mild soap and lukewarm water using a soft brush. Store separately to help preserve the finish and maintain the setting.
Are these earrings suitable for gifting?
The floral design and secure setting make them appropriate for birthdays, anniversaries, and other meaningful occasions.