Certified Lab Grown Diamond Floral Drop Earrings

0
Regular price $2,459
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Certified Lab Grown Diamond Floral Drop Earrings

These floral drop earrings are designed for those who appreciate graceful detail and quiet sophistication. The design balances decorative form with everyday practicality, making them suitable for gifting or personal wear.

Crafted with certified lab grown diamonds, the earrings offer visual clarity and refined sparkle without excessive ornamentation, appealing to buyers who prefer elegance over trend-driven styles.

Floral Drop Design & Setting

The floral motif is structured to create soft movement while maintaining visual balance when worn. The drop design adds length and fluidity without overwhelming the overall silhouette.

Each diamond is set to support security and comfort, allowing the earrings to sit naturally throughout the day.

Lab Grown Diamond Value

Lab grown diamonds are selected for their durability and suitability for regular wear. These stones are created without traditional mining, though impact varies by production and energy source.

Their placement enhances light interaction while preserving the integrity of the floral design.

High-Level Features

  • Floral-inspired drop earring design
  • Certified lab grown diamonds
  • Balanced proportions for natural movement
  • Refined construction suitable for regular wear
Product Information
SKU SHP-EARRINGS122310135
Metal Weight 6.00 gm (Approximate)
Total Stone Weight 2.82 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 156 Pieces
Total Weight 2.82 Carat (Approximate)
Dimension(approx) Princess Cut-5X5 mm-2 Pcs
Round-1.50X1.50 mm-8 Pcs
Round-1.20X1.20 mm-32 Pcs
Round-1.10X1.10 mm-114 Pcs
Color E-F
Cut Brilliant
Shape Princess Cut, Round
Setting Type Prong-Setting
Quality Grade VS
View More
Are these earrings suitable for everyday wear?
The design and secure setting make them appropriate for regular wear with proper care.
What makes lab grown diamonds durable?
Lab grown diamonds share the same hardness and structural properties as mined diamonds.
Do the earrings have noticeable movement when worn?
The drop design allows gentle movement while remaining balanced on the ear.
Are these earrings heavy on the ears?
They are designed to feel lightweight and comfortable for extended wear.
How should these earrings be maintained?
Clean gently with a soft cloth and mild solution, and store separately to avoid contact with other jewelry.