Certified Lab Grown Diamond Catholic Cross Heart Necklace

0
Sale price $1,200 Regular price $1,379
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Faith and Devotion

The Certified Lab Grown Diamond Catholic Cross Heart Necklace brings together two meaningful symbols in one refined design. The cross represents faith and spiritual strength, while the heart reflects love and personal devotion. Thoughtfully crafted for those who value both belief and elegance, this necklace is suitable for everyday wear or meaningful gifting.

Balanced Design with Defined Detail

The cross and heart elements are proportioned to sit gracefully along the neckline without appearing heavy. Lab grown diamonds are set to enhance light reflection while maintaining a clean, structured outline. For exact stone specifications, dimensions, metal options, and total carat weight, please refer to the product detail tables above.

Lab Grown Diamond Characteristics

Lab grown diamonds offer the same physical and optical properties as mined diamonds. They are created without traditional mining, though environmental impact varies by production and energy source. Certification and grading details are provided in the specifications section above for complete clarity.

High-Level Features

  • Catholic cross and heart motif in a unified pendant design.
  • Set with certified lab grown diamonds for refined brilliance.
  • Meaningful styling suitable for daily wear or special occasions.
  • Available in multiple precious metal options as listed above.
Product Information
SKU SHP-PENDANT022510072
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-9 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1.10X1.10 mm-3 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade VS
View More

FAQs About: Lab Grown Diamond Catholic Cross Heart Necklace

Does this necklace include a chain?
Please review the product detail tables above to confirm whether the chain is included and to see available length options.
Are the diamonds certified?
Certification details and grading information are provided in the product specification section above for complete transparency.
Is a lab grown diamond real?
Lab grown diamonds have the same physical and optical properties as mined diamonds and are considered real diamonds.
Can this necklace be worn daily?
Lab grown diamonds are durable and suitable for regular wear when properly cared for. Routine cleaning helps maintain brilliance.
What metal options are available?
Available metal types and finishes are listed in the product detail tables above. Please refer to that section for accurate information.