Certified Lab 0.9 Carat Round Diamond Infinity Pendant Necklace

0
Regular price $1,299
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Continuity and Meaning

The Certified Lab 6 mm Round Diamond Infinity Pendant Necklace is designed for those who value symbolism in fine jewelry. The infinity motif represents enduring connection, while the round diamond adds a focused point of brilliance at the center.

Its refined scale makes it suitable for milestone gifting, anniversaries, or as a meaningful everyday pendant that pairs easily with both formal and casual attire.

Infinity Design with Centered Brilliance

The infinity framework creates a smooth, continuous silhouette that naturally draws the eye toward the round diamond. This balanced composition enhances light reflection while preserving a clean and structured appearance.

The diamond placement is engineered for stability and visual symmetry. For detailed information regarding the setting style, metal options, dimensions, and total carat weight (if applicable), please refer to the product specification tables provided on this page.

Certified Lab Grown Diamond Value

Lab grown diamonds share the same physical, chemical, and optical properties as mined diamonds. They are created without traditional mining, though impact varies by production and energy source.

Certification confirms the diamond’s grading based on established standards. Exact clarity, color, and measurement details are listed in the product detail tables above.

High-Level Features

  • Infinity motif symbolizing continuity and lasting connection.
  • 6 mm round diamond positioned for balanced brilliance.
  • Certified lab grown diamond with verified grading.
  • Metal choices and full specifications provided in the product tables.
Product Information
SKU SHP-PENDANT022510073
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 1.07 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 1.07 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Round-1.20X1.20 mm-1 Pcs
Round-1.10X1.10 mm-12 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs about: Certified Lab 6 mm Round Diamond Infinity Pendant Necklace

What does the infinity symbol represent in jewelry?
The infinity symbol commonly represents continuity, lasting connection, and enduring commitment, making it a meaningful choice for gifting or personal wear.
Are lab grown diamonds considered real diamonds?
Yes. Lab grown diamonds have the same physical, chemical, and optical characteristics as mined diamonds. They are produced in controlled environments rather than extracted from the earth.
What does diamond certification mean for this pendant?
Certification indicates that the diamond has been evaluated and graded according to recognized gemological standards. Specific grading details are provided in the product specification tables.
Is this pendant suitable for everyday wear?
Diamond pendants are commonly chosen for regular wear due to their durability. Suitability also depends on individual lifestyle and proper care practices.
Where can I verify the metal type and measurements?
All verified specifications, including metal type, measurements, diamond grading, and other technical details, are listed in the product detail tables on this page.