Certified Diamond Star Chain Earrings

0
Regular price $1,249
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Delicate Statement with Movement

The certified diamond star chain earrings are designed for those who appreciate subtle motion paired with fine detailing. The star motif introduces a symbolic element, while the chain structure creates gentle movement with every turn. This combination offers a refined drop style that feels expressive yet composed.

Star Motif & Chain Construction

Each earring features a star-inspired design accented with certified diamonds, connected through a fine chain element. The chain allows the piece to move naturally, enhancing light reflection and adding dimension without excessive weight. This structure balances decorative form with a streamlined silhouette suited for modern styling.

Certified Diamond Characteristics

Crafted with certified diamonds, these earrings offer enduring brilliance suitable for regular wear. Diamonds are valued for their durability and consistent sparkle, making them appropriate for fine jewelry intended for long-term use. With proper care and storage, their clarity and finish can be maintained over time.

High-Level Features

  • Star-inspired design accented with certified diamonds.
  • Chain drop structure for subtle movement and light play.
  • Balanced profile suited for everyday and occasion wear.
  • Available in multiple precious metal options.
Product Information
SKU SHP-EARRINGS121911318
Length 57 mm
Width 10 mm
Height 3 mm
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 0.52 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 104 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Round-1X1 mm-54 Pcs
Round-0.90X0.90 mm-50 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
moissanite-earrings

FAQs About: Certified Diamond Star Chain Earrings

Are these earrings made with certified diamonds?
Yes. The product specifies certified diamonds. Please refer to the product specification tables for complete grading information.
Are these earrings lightweight for regular wear?
The chain design is created to allow movement while maintaining a balanced structure suitable for extended wear.
Are the earrings sold as a pair?
Please review the product specification tables to confirm whether the item is sold individually or as a pair.
What metal options are available?
Available metal selections are listed in the product options and detailed in the product specification tables on the page.
Are these earrings suitable for special occasions?
The star motif and chain drop design make them suitable for both everyday styling and formal occasions.
How should I care for these earrings?
Clean gently with mild soap and lukewarm water using a soft brush. Store separately to help preserve the finish and setting.