Certified Diamond Flower Hoop Earrings For Women

0
Regular price $1,019
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

As a modern street style, these Diamond Hoop Earrings balance timeless design with contemporary elegance. Seamlessly blending modern aesthetics with classic charm, these Huggie Hoop Earrings are perfect for understated sophistication. The Round brilliant cut Diamond makes a brilliant flower shape motif on the front facet. Also, the natural Diamond scattered over the hoop is a stunning preference for the nature loving individuals. These Diamond Huggie Earrings add a touch of whimsical charm to your look with a delicate floral design that creates a display of sparkle and shine. As a blend of timeless design and contemporary appeal, these Flower Hoop Earrings have a simplicity in design and are substantial and eye-catching, giving a modern and defined appearance. The bouquet collection is inspired by the deep tradition of giving flowers at performances. As a celebration of your beauty, grace and powerful craftsmanship, these Diamond Huggie Hoops are the perfect balance of professional and stylish.

Product Information
SKU SHP-EARRINGS121911418
Length 12 mm
Width 5.5 mm
Height 1.5 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.78 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.78 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Round-1.80X1.80 mm-10 Pcs
Round-2X2 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings