Certified 4 Carat Round Lab Grown Diamond Flower Dangle Earrings

0
Sale price $1,730 Regular price $1,989
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed to move with light and feeling, these certified lab grown diamond flower dangle earrings bring together a delicate floral motif, a fine cable chain, and a round diamond drop. Each earring begins with a diamond-encrusted flower at the top, then falls into an 8 mm round lab grown diamond for a graceful dangle effect. Polished, feminine, and full of sparkle, the pair makes a thoughtful choice for April birthstone gifting, anniversaries, birthdays, evening occasions, or a meaningful jewelry moment that feels fresh and celebratory.

Flower Inspired Dangle Earrings with Certified Lab Grown Diamond

These dangle earrings are crafted with 18 round lab grown diamonds in white color and EF-VS quality, creating an approximate total diamond weight of 4.21 carats. The design includes two 8 x 8 mm round lab grown diamonds as the main drops and sixteen 1.20 x 1.20 mm round diamonds forming the floral top detail. Brilliant cut faceting, prong settings, screw-back closures, and precious metal options give the earrings a refined balance of secure wear, luminous movement, and floral-inspired charm.

What Makes This Special

The earrings feature 18 round lab grown diamonds with an approximate total weight of 4.21 carats. The main dangle stones include 2 round lab grown diamonds measuring approximately 8 x 8 mm, giving the pair a striking diamond presence below the floral motif.

The flower detail is accented with 16 round lab grown diamonds measuring approximately 1.20 x 1.20 mm. These smaller stones create the diamond-encrusted floral top, while the cable chain adds graceful movement between the flower motif and the round diamond drops.

The lab grown diamonds are white in color, round in shape, brilliant cut, EF-VS quality grade, and secured in prong settings. The pair has an approximate weight of 2.00 gm and is finished with screw-back closures for secure wear. Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Why Choose This Design

The flower motif gives the earrings a soft, romantic beginning, while the cable chain and round diamond drop create movement that catches light with every turn. This makes the design more expressive than a classic stud, yet still refined enough for polished styling.

The 8 mm round lab grown diamonds create a noticeable focal point, while the smaller floral diamonds add texture and detail near the ear. Prong settings help keep each stone visible and bright, and the screw-back closure supports confident wear for celebrations, gifting, and special evenings.

Design Meaning

Flowers often symbolize growth, joy, affection, and meaningful new beginnings. In these earrings, the floral diamond top paired with the moving round diamond drop creates a design that feels both graceful and celebratory. As an alternative April birthstone gift, the lab grown diamond sparkle also carries a sense of strength, clarity, and lasting sentiment.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to lab grown diamond selection, floral alignment, prong setting security, cable chain connection, screw-back comfort, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for wearing or gifting. For lasting care, store the earrings separately, avoid harsh chemicals, and wipe them gently with a soft cloth after wear.

Style and Wearability

These lab grown diamond flower dangle earrings frame the face with sparkle at the lobe and movement below it. Their floral top and round diamond drops make them ideal for dinners, weddings, formal celebrations, date nights, and meaningful gifting. They pair beautifully with diamond pendants, slim tennis bracelets, floral rings, solitaire bands, and both warm or cool metal jewelry depending on the selected metal.

Product Information
SKU SHP-EARRINGS022510032
Weight 2.00 gm (Approximate)
Center Stone Weight 4.21 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 4.21 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-16 Pcs
Round-8X8 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

FAQs About: Certified 8 MM Round Lab Grown Diamond Flower Dangle Earrings

What makes these lab grown diamond flower earrings a meaningful gift?

The floral motif can symbolize affection, joy, growth, and new beginnings, while the lab grown diamonds add lasting sparkle. This makes the earrings a thoughtful choice for birthdays, anniversaries, April birthstone gifting, weddings, and special celebrations.

How many lab grown diamonds are used in these earrings?

The earrings include 18 round lab grown diamonds with an approximate total weight of 4.21 carats. The layout includes 16 round diamonds measuring approximately 1.20 x 1.20 mm and 2 round diamonds measuring approximately 8 x 8 mm.

What cut, color, and quality are listed for the diamonds?

The lab grown diamonds are round in shape with brilliant cut faceting. They are white in color and listed with an EF-VS quality grade.

What setting and closure style do these earrings have?

The lab grown diamonds are secured in prong settings, which help keep the stones visible and bright. The earrings are finished with screw-back closures for a secure and comfortable fit.

What makes the flower dangle design special?

The earrings combine a diamond-encrusted flower motif with a cable chain and an 8 mm round diamond drop. This creates a graceful dangle effect with floral detail at the top and visible sparkle below.

What metal options are available for these diamond dangle earrings?

This design is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, giving buyers several choices in metal tone and purity.

How should I care for these lab grown diamond flower dangle earrings?

Store the earrings separately to help prevent scratches and chain tangling, avoid harsh chemicals, and wipe them gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry the earrings carefully before storing.