Black Onyx and Diamond Half Eternity Leaf Band for Women

0
Regular price $659
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Black Onyx and Diamond Half Eternity Leaf Band for Women

The Black Onyx and Diamond Half Eternity Leaf Band for Women blends bold contrast with organic detail. Designed with alternating black onyx and diamond accents in a leaf-inspired motif, this band offers a distinctive look that feels both refined and expressive. Its half eternity layout provides balanced sparkle across the visible portion of the ring while maintaining everyday comfort.

Design & Leaf-Inspired Setting

The leaf motif introduces a soft, nature-inspired rhythm to the band, creating gentle curves and structured detailing along the surface. The contrast between the deep tone of black onyx and the brilliance of diamonds enhances the visual depth of the design. As a half eternity style, stones are set along the upper portion of the band, allowing for ease of wear while preserving decorative impact.

About Black Onyx & Diamond

Black onyx is valued for its smooth finish and bold, opaque appearance, offering a sleek foundation for contrast. Diamonds add light and clarity, balancing the darker tones with refined brilliance. With mindful care and regular cleaning, this combination can maintain its polished look over time.

Key Highlights

  • Half eternity style: stones set along the top for comfort and balance.
  • Leaf-inspired motif: nature-influenced detailing.
  • Black onyx and diamond contrast: bold yet elegant aesthetic.
  • Versatile wear: suitable as a wedding band or stacking ring.
Product Information
SKU SHP-RINGS0821237553
Width 6 mm
Height 2.5 mm
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 1.14 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 9 Pieces
Total Weight 0.81 Carat (Approximate)
Dimension(approx) Round-3X3 mm-9 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 27 Pieces
Total Weight 0.33 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-9 Pcs
Round-1X1 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings
What does half eternity mean?
A half eternity ring features stones set along the upper portion of the band rather than encircling the entire ring, offering decorative detail with added comfort.
Is this band suitable for stacking?
Yes, its balanced profile allows it to be worn alone or paired with engagement rings and other bands for a layered look.
Is black onyx suitable for daily wear?
Black onyx can be worn daily with mindful care. Avoiding impact and exposure to harsh chemicals can help preserve its finish.
What occasions is this ring suitable for?
This band can be worn as a wedding ring, anniversary band, or a distinctive stacking piece for everyday styling.
Who is this ring ideal for?
It is ideal for someone who appreciates nature-inspired details combined with bold gemstone contrast.