Alternating Set Lab Emerald and Moissanite Full Eternity Ring

0
Regular price $1,169
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This eternity ring features an alternating sequence of lab emeralds and moissanite gemstones, forming a continuous band of color and brilliance. The combination of deep green emerald tones and the bright sparkle of moissanite creates a balanced design that highlights both gemstones equally.

The full eternity structure encircles the entire band with gemstones, symbolizing continuity while offering a visually striking arrangement.

Alternating Gemstone Arrangement

Alternating gemstone designs introduce contrast and rhythm to eternity rings. By placing emeralds and moissanite stones in sequence, the design maintains a balanced visual flow that emphasizes both color and light.

This structured pattern allows each gemstone to stand out individually while contributing to the harmony of the overall ring design.

Full Eternity Ring Design

A full eternity ring features gemstones that extend around the entire circumference of the band. This design creates a continuous appearance of gemstones from every viewing angle.

The uninterrupted layout enhances the visual impact of the ring and emphasizes symmetry within the jewelry design.

Emerald and Moissanite Combination

Emeralds are known for their rich green color, while moissanite gemstones are valued for their brightness and reflective qualities. Together they create a combination of vivid color and brilliance that adds depth to the ring.

This pairing allows the ring to present both gemstone color and sparkle without relying on a single stone type.

Lab Created Emerald Characteristics

Lab created emeralds are produced in controlled environments rather than extracted through traditional mining processes. They share similar visual characteristics with natural emeralds.

These gemstones are created without traditional mining, though environmental impact may vary depending on production and energy sources.

Product Information
SKU SHP-RINGS052185248
Width 3.2 mm
Height 2 mm
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 2.31 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 11 Pieces
Total Weight 1.32 Carat (Approximate)
Dimension(approx) Round-3X3 mm-11 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 11 Pieces
Total Weight 0.99 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-11 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade D-VS1
View More

FAQs About: Alternating Set Lab Emerald and Moissanite Full Eternity Ring

What is a full eternity ring?
A full eternity ring features gemstones set continuously around the entire band, creating a design that appears the same from every angle.
Why combine emeralds and moissanite in a ring?
Emeralds add vivid green color while moissanite provides bright sparkle, creating a ring that highlights both color and brilliance.
What is moissanite?
Moissanite is a gemstone known for its strong brilliance and durability, making it a popular choice in fine jewelry designs.
What makes emeralds distinctive in jewelry?
Emeralds are valued for their vibrant green color and have long been used in jewelry for their distinctive appearance.
Are eternity rings suitable as wedding bands?
Eternity rings are often chosen as wedding or anniversary bands because their continuous gemstone design symbolizes lasting commitment.
Can gemstone eternity rings be worn daily?
Many gemstone eternity rings can be worn regularly depending on their setting design and gemstone durability.