8 Carat Freshwater Pearl Drop Pendant with Diamond

0
Sale price $1,040 Regular price $1,169
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make your style more elegant with this amazing Freshwater Pearl Necklace that combines classic beauty with modern design. The necklace features a 8 Carat Round Freshwater Pearl set in a bead setting. At the top is a marquise shaped motif studded with dainty diamonds and a beaded border that adds drama to the contemporary look. This Real Pearl Necklace is known for elegance, sophistication, and timeless beauty, and it stands out because of its unique design and understated charm. It enhances your outfit by making a subtle statement. As a romantic piece, this White Pearl Necklace creates a look that is both timeless and modern. The delicate design of the necklace shows off purity and elegance while reflecting your personal style. As a symbol of timeless elegance, it makes you feel effortlessly stylish. So, get attention with this stunning AAA Quality Freshwater Pearl and HI Color SI Clarity real Diamonds that brighten your look and are a treasured piece of jewelry for every occasion. This Freshwater Pearl and Diamond Necklace brings together the organic shine of the pearl and the sparkle of the genuine diamonds, creating a poetic masterpiece that celebrates both natural grace and artistic refinement.

Product Information
SKU SHP-PENDANT062189839
Metal Weight 2.60 gm (Approximate)
Total Stone Weight 8.07 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-necklaces