4 Carat Oval Shape Lab Created Blue Sapphire Statement Necklace with Moissanite

0
Sale price $1,069 Regular price $1,229
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Experience the enduring charm of this Lab Blue Sapphire Necklace, a creation intended to honor elegance, femininity, and timeless beauty. Meticulously crafted, this stunning piece showcases an 8×10 mm oval-shaped lab-created Blue Sapphire, elegantly set in a traditional prong setting, exuding a deep and enchanting blue tone. Encircling the central stone, a halo of brilliant-cut moissanite contributes remarkable brilliance, perfectly accentuating the sapphire’s depth and luminosity. Enhancing the design, marquise and pear-shaped moissanite gemstones create a delicate floral pattern at the top, adding a graceful and romantic element to this exquisite floral pendant. Hanging from a sophisticated 18-inch chain, this oval shape necklace effortlessly brightens your neckline, serving as a striking statement piece for both grand occasions and refined daily wear. Drawing inspiration from the beauty of nature, the floral motif represents love, growth, and new beginnings—rendering this Drop Necklace particularly significant for life’s most treasured moments. Ideal for weddings, engagements, anniversaries, cocktail parties, and formal gatherings, this created sapphire necklace complements bridal gowns, evening dresses, and festive outfits beautifully. It also serves as a thoughtful and memorable gift for birthdays, anniversaries, Valentine’s Day, Mother’s Day. Whether commemorating a significant event or conveying love and gratitude, this necklace communicates profound sentiments without uttering a single word. Crafted to be cherished for years, this Halo pendant transcends mere jewelry—it embodies elegance, romance, and lasting style.

Product Information
SKU SHP-PENDANT042310011
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 5.10 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 4.00 Carat (Approximate)
Dimension(approx) Oval-8X10 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 18 Pieces
Total Weight 1.10 Carat (Approximate)
Dimension(approx) Pear-2.00X3.50 mm-2 Pcs
Round-2X2 mm-13 Pcs
Marquise-2X4 mm-3 Pcs
Color White
Cut Brilliant
Shape Pear, Round, Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
lab-created-blue-sapphire-necklace