2 Carat Lab Grown Diamond Emerald Flower Bridal Necklace

0
Regular price $2,659
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Bridal Necklace with Floral Elegance

This lab grown diamond emerald flower bridal necklace is designed for those seeking a refined statement piece for special occasions. The floral-inspired design introduces a soft and structured aesthetic, creating a balanced focal point along the neckline.

Its composition makes it suitable for bridal wear while remaining versatile for formal events.

Floral Motif with Structured Setting

The flower-inspired arrangement is crafted to highlight the contrast between shapes and colors, creating a cohesive and visually engaging design. Each element is placed to maintain symmetry while allowing the necklace to sit comfortably.

The structured setting supports the overall form, ensuring stability without compromising the fluid appearance of the design.

Lab Grown Diamonds with Emerald Accents

Lab grown diamonds provide consistent clarity and light reflection, offering a refined brilliance that complements the floral design. Emerald accents introduce a distinct color contrast, enhancing the overall composition.

The diamonds are created without traditional mining, though impact varies by production and energy source.

Designed for Occasion Wear

This necklace is intended for formal and bridal settings, where its detailed design can be fully appreciated. Its structure allows for comfortable wear while maintaining a defined and elegant presence.

It can be styled as a standalone statement piece or paired with complementary jewelry for a coordinated look.

Product Information
SKU SHP-PENDANT022510019
Weight 3.59 gm (Approximate)
Center Stone Weight 2.16 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 2.16 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
EMERALD INFORMATION
No.of Stones 8 Pieces
Total Weight 1.58 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-8 Pcs
Color Green
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA

View More

Product Parent Collection Handle
lab-created-emerald-necklace

FAQs About: 2 Carat Lab Grown Diamond Emerald Flower Bridal Necklace

Is this necklace suitable for bridal wear?
Yes, its floral design and refined structure make it suitable for bridal and formal occasions.
What does the flower design represent?
Floral designs are often associated with elegance, growth, and timeless beauty.
Are lab grown diamonds suitable for jewelry?
Lab grown diamonds are commonly used in jewelry and can be worn regularly with proper care.
Does the necklace include a chain?
Please refer to the product details table to confirm whether a chain is included with the necklace.
Can this necklace be worn on other occasions?
Yes, it can be worn for formal events and special occasions beyond bridal use.
How should this necklace be maintained?
Clean gently with a soft cloth, avoid harsh chemicals, and store separately to maintain its finish and stones.