2 Carat Lab Grown Diamond Emerald Flower Bridal Necklace

0
Sale price $1,791 Regular price $2,059
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed to bring color, brilliance, and floral symbolism to a wedding-day look, this lab grown diamond and lab created emerald bridal necklace creates a striking focal point at the neckline. A large round white diamond sits at the heart of the flower, surrounded by pear-shaped green emerald petals and smaller diamond accents. The combination of fresh green color and bright diamond sparkle makes it a meaningful choice for bridal wear, anniversaries, milestone celebrations, or a jewelry gift that represents growth and a new chapter.

2 Carat Lab Grown Diamond and Emerald Flower Bridal Necklace

The floral centerpiece combines nine round brilliant-cut lab grown diamonds totaling approximately 2.16 carats with eight pear-shaped lab created emeralds totaling approximately 1.58 carats. An approximately 8 x 8 mm round diamond forms the central focal point, while eight smaller 1.5 x 1.5 mm round diamonds add light between the emerald petals. Each green emerald measures approximately 3 x 5 mm. All stones are secured in prong settings, and the necklace is crafted in 92.5 sterling silver with an approximate weight of 3.59 grams. It can be selected with an 18-inch chain or without a chain.

What Makes This Diamond and Emerald Flower Necklace Special

  • Floral stone arrangement: Eight pear-shaped lab created emeralds radiate around the round diamond center to create a defined flower motif.
  • Lab grown diamond sparkle: Nine white, round brilliant-cut diamonds provide approximately 2.16 carats of combined diamond weight.
  • Emerald color contrast: Eight AAAA-grade green lab created emeralds contribute approximately 1.58 carats of vivid floral detail.
  • Diamond quality: The lab grown diamonds are listed with EF color and VS quality.
  • Secure prong settings: Both the diamonds and emeralds are individually prong set to support the multi-stone floral composition.
  • Chain flexibility: Choose the pendant with an 18-inch chain or without a chain to suit your styling preference.

Meaning Behind the Lab Grown Emerald Flower Bridal Necklace

The flower composition makes this necklace especially suited to celebrations of growth, partnership, and new beginnings. Pear-shaped emeralds naturally form petal-like outlines around the round diamond center, while the alternating white and green stones create definition across the entire motif. For a bride, the design offers more than sparkle alone: its floral form can reflect a relationship entering a new chapter, while the green emerald color brings individuality to traditional bridal jewelry. The arrangement also gives each stone a clear visual role without making the design feel crowded.

Lab Grown Diamond Necklace Authenticity & Craftsmanship

Rosec Jewels carefully crafts this diamond and lab created emerald necklace with attention to stone placement, prong security, symmetry, and refined finishing. The jewelry is checked by hand, and Rosec Jewels offers a Certificate of Authenticity with the piece for added product confidence. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. Care guidance also supports long-term ownership, helping you protect the sterling silver finish and multi-stone floral setting with gentle cleaning and proper storage.

Styling a Diamond and Emerald Bridal Necklace

The round white diamond draws the eye to the center, while eight green pear-shaped emeralds create a petal-like frame that reads clearly from the front. Worn with the available 18-inch chain, the floral pendant can serve as the main jewelry statement with a bridal gown, reception dress, or formal evening look. It can also be paired with understated diamond or emerald earrings for a coordinated finish. Beyond the wedding day, its colored gemstone design makes it suitable for anniversaries, formal celebrations, and meaningful gifting.

Product Information
SKU SHP-PENDANT022510019
Weight 3.59 gm (Approximate)
Center Stone Weight 2.16 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 2.16 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
LAB CREATED  EMERALD INFORMATION
No.of Stones 8 Pieces
Total Weight 1.58 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-8 Pcs
Color Green
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAAA

View More

Product Parent Collection Handle
lab-created-emerald-necklace

FAQs About: 2 Carat Lab Grown Diamond Emerald Flower Bridal Necklace

What stones are used in this diamond and emerald flower bridal necklace?

The necklace combines nine round brilliant-cut lab grown diamonds with eight pear-shaped lab created emeralds. The diamonds total approximately 2.16 carats and have EF-VS quality, while the green AAAA-grade emeralds total approximately 1.58 carats.

How is the flower design created in this bridal necklace?

An approximately 8 x 8 mm round lab grown diamond forms the center of the flower. Eight 3 x 5 mm pear-shaped lab created emeralds surround it like petals, while eight smaller 1.5 x 1.5 mm round diamonds add extra sparkle around the floral arrangement.

What setting is used for the lab grown diamonds and lab created emeralds?

The round lab grown diamonds and pear-shaped lab created emeralds are secured in prong settings. This approach supports the individual stones while keeping the flower-shaped arrangement visually defined.

Is this emerald flower necklace suitable for bridal wear?

Yes. The floral motif, central diamond sparkle, and contrasting green emerald petals make it particularly suited to bridal styling. The flower can also carry associations with growth and new beginnings, making the design meaningful for a wedding, anniversary, or milestone gift.

What metal and chain options are available for this bridal necklace?

The necklace is crafted in 92.5 sterling silver. It can be selected with an 18-inch chain or without a chain, allowing you to choose the option that best suits your jewelry collection and preferred neckline styling.

Does this lab grown diamond and emerald necklace come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with the jewelry. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a sterling silver diamond and emerald necklace?

Store the necklace separately when it is not being worn, keep it away from harsh chemicals and abrasive surfaces, and clean it gently with a soft jewelry cloth. Because the design contains multiple prong-set stones, careful handling and periodic checks of the settings can help maintain the security of the diamonds and emeralds.