2.5 Carat Lab Created Pink Sapphire Teardrop Engagement Ring with Surprise Diamond

0
Sale price $974 Regular price $1,119
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

A ring chosen for a life-changing moment should feel personal from the first glance. This 2.5 Carat Lab Created Pink Sapphire Teardrop Engagement Ring with Surprise Diamond brings together a vivid pear-shaped pink sapphire, a hidden diamond accent, and a twisted rope band that feels rich with meaning. The teardrop center creates a romantic focal point, while the surprise diamond tucked beneath the sapphire adds a private touch of brilliance for the wearer to discover.

Designed for proposals, anniversaries, or a gift that marks a deeply personal promise, this engagement ring balances expressive color with refined detail. The pink sapphire gives the design a soft yet confident presence, and the rope-inspired band adds a feeling of connection, strength, and shared devotion.

2.5 Carat Lab Created Pink Sapphire Teardrop Engagement Ring with Surprise Diamond

Crafted with a 7X10 mm pear-shaped lab created pink sapphire of AAAA quality, this ring centers on a brilliant-cut pink gemstone weighing approximately 2.50 carats. A round brilliant-cut lab grown diamond of approximately 0.07 carat rests beneath the center stone as a surprise accent, adding a subtle flash of white sparkle. The ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, allowing the design to be styled in the metal tone that best suits the wearer.

What Makes This Special

The center stone is a pear-shaped lab created pink sapphire with an approximate 7X10 mm dimension and a brilliant cut that helps draw light through its teardrop silhouette. Its AAAA quality grade and pink color give the ring a vibrant, romantic character without relying on a traditional colorless center stone.

A single round lab grown diamond, approximately 2.50X2.50 mm, is placed as a surprise detail beneath the sapphire. With EF-VS quality and a white tone, this hidden diamond adds a thoughtful layer of sparkle that feels intimate rather than overstated.

The twisted rope band gives the design its distinctive profile. Measuring approximately 5.5 mm in width and 10.6 mm in height, the ring has a defined presence on the hand while keeping the focus on the pear-shaped sapphire and the meaningful band detail.

Why Choose This Design

The pear cut is loved for the way it combines softness and direction. Its rounded base brings romance, while the tapered point lengthens the look of the finger and gives the ring a graceful teardrop outline. In pink sapphire, that shape feels especially expressive, making the ring a meaningful choice for someone who wants an engagement design with color, personality, and emotional warmth.

The surprise diamond makes the ring feel more personal. Rather than surrounding the center stone with a visible halo or side-stone layout, the design keeps the sapphire as the main focus and reserves the diamond sparkle as a hidden detail. The rope-style band adds texture and symbolism, creating a ring that feels considered from every angle.

Design Meaning

The teardrop form carries a graceful sense of emotion, making it well suited for a proposal, anniversary, or promise that deserves a distinctive symbol. Its pink sapphire center speaks to affection, tenderness, and individuality, while the hidden diamond adds the feeling of a private vow held close beneath the center stone.

The twisted rope motif brings another layer of meaning. Two strands moving together can represent unity, strength, and connection, making the band more than a decorative detail. For a relationship built on loyalty and shared direction, this design becomes a wearable reminder of two lives intertwined.

Authenticity & Craftsmanship

Rosec Jewels crafts this ring with close attention to stone placement, setting security, and final finish. The lab created pink sapphire and lab grown diamond are inspected before setting, the completed ring is reviewed for stone security, and the finishing is checked before dispatch. The ring is offered as certified jewelry, and Rosec Jewels provides customer care guidance to help preserve the ring’s shine, including gentle cleaning, careful storage, and avoiding harsh chemicals during wear.

Style and Wearability

This ring has a romantic front-facing impact from the pear-shaped sapphire, while the hidden diamond and rope band reward a closer look. The design pairs beautifully with both minimal and textured jewelry, and the available sterling silver and gold options make it easy to choose a finish that suits the wearer’s everyday style.

Its expressive pink center stone makes it especially meaningful for a proposal or milestone gift, while the comfortable craftsmanship and secure setting make it suitable for regular wear with proper care. Whether worn alone as a statement engagement ring or paired with a coordinating band, it carries color, sentiment, and thoughtful detail in one design.

Product Information
SKU SHP-RINGS052310673
Width 5.5 mm
Height 10.6 mm
Weight 2.80 gm (Approximate)
Center Stone Weight 2.50 Carat (Approximate)
LAB CREATED PINK SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 2.50 Carat (Approximate)
Dimension(approx) Pear-7X10 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Pear
Setting Type Other-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Other-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-pink-sapphire-rings

FAQs About: 2.5 Carat Lab Created Pink Sapphire Teardrop Engagement Ring with Surprise Diamond

What makes this pink sapphire ring suitable for a proposal?

This ring is designed around a 2.50 carat pear-shaped lab created pink sapphire, giving it a romantic color and a distinctive teardrop silhouette. The hidden lab grown diamond beneath the center stone adds a private, meaningful detail, while the twisted rope band symbolizes strength and unity, making it a thoughtful choice for an engagement or promise.

What stone is used as the center stone?

The center stone is one pear-shaped lab created pink sapphire measuring approximately 7X10 mm. It has an approximate weight of 2.50 carats, a brilliant cut, pink color, and AAAA quality grade.

Does this ring include any diamond detail?

Yes. The design includes one round brilliant-cut lab grown diamond placed as a surprise accent beneath the pink sapphire. The diamond measures approximately 2.50X2.50 mm, weighs approximately 0.07 carat, and has EF-VS quality with a white color grade.

What does the twisted rope band symbolize?

The twisted rope band represents strength, unity, and connection. Its two-strand look gives the ring emotional depth, making it especially fitting for a commitment piece that celebrates two lives moving forward together.

Which metal options are available for this ring?

This ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These options allow the same pink sapphire and surprise diamond design to be styled in a cool, warm, or richer gold tone.

Is this ring suitable for daily wear?

The ring is crafted for a comfortable fit and can be worn regularly with proper care. To help maintain its finish and stone setting, remove it during heavy work, workouts, swimming, or exposure to harsh chemicals, and store it separately when not in use.

How should I care for this lab created pink sapphire and diamond ring?

Clean the ring gently with mild soap, lukewarm water, and a soft brush, then dry it with a lint-free cloth. Avoid abrasive cleaners and chemical exposure, and keep the ring in a separate jewelry pouch or box to reduce scratches and protect the setting.