14.9 Carat Genuine Freshwater Pearl and Diamond Drop Earrings with Certificate

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Rosec Jewels classic Freshwater Pearl Drop Earrings beautifully combine elegance with a modern touch. Each earring showcases an 8 MM round freshwater pearl that gracefully hangs below. The pearl is securely set in simple bead design, allowing its natural beauty to take center stage without any distractions. At the top, a leaf-like motif is adorned with small round diamonds. The combination of HI-SI quality diamonds and AAA quality freshwater pearl results in a timeless appearance that is perfect for both daily wear and special events. Designed with comfort and security in mind, these Freshwater Pearl and Diamond Earrings feature screw back closures. This guarantees a snug and dependable fit, so you can wear them confidently all day long. Lightweight and versatile, they complement both casual and formal outfits effortlessly. These Freshwater Cultured Pearl Earrings make a wonderful gift for birthdays, anniversaries, or weddings. This pair includes a certificate of authenticity, assuring you that you are receiving high quality stones and comes beautifully packaged in a lovely jewelry box.

Product Information
SKU SHP-EARRINGS062199261
Length 18 mm
Width 8 mm
Height 1.8 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 15.06 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 14.96 Carat (Approximate)
Dimension(approx) Round-8X8 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-10 Pcs
Round-1X1 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-earrings