14.9 Carat Freshwater Pearl Drop Earrings with Diamond Accents

0
Regular price $919
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a touch of elegance and charm to any special occasion with a pair of Freshwater Pearl Drop Earrings designed for timeless beauty. At the top, round diamonds form a delicate leafy motif, adding soft sparkle and graceful detail. From this design hangs an 8 MM round freshwater pearl, set in secure bead setting, moving gently with every step and catching the light beautifully. The Pearl and Diamond Earrings feature a screw back closure, ensuring a comfortable and secure fit for all-day wear. The smooth pearl drop balances perfectly with the sparkling diamonds, creating a classic and graceful look suitable for weddings, anniversaries, or other special moments. As June’s birthstone, freshwater pearls symbolize purity, calm, and balance, making these Freshwater Cultured Pearl Earrings meaningful as well as stunning. They make a thoughtful gift for a loved one or a cherished addition to a personal jewelry collection. Perfect for brides or anyone who loves elegant jewelry, these Wedding Drop Earrings add a touch of sophistication and beauty to every outfit, creating lasting memories on every special day.

Product Information
SKU SHP-EARRINGS0721114769
Length 21 mm
Width 3.8 mm
Metal Weight 1.30 gm (Approximate)
Total Stone Weight 15.15 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 14.96 Carat (Approximate)
Dimension(approx) Round-8X8 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-6 Pcs
Round-1.10X1.10 mm-10 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1X1 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-earrings