1.5 Carat Lab Created Ruby Oval Engagement Ring with Diamonds

0
Regular price $1,409
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance your appearance with this alluring Lab Created Ruby Engagement Ring. Adorned with a 1.5 Carat Oval Cut Lab Grown Ruby with Marquise Cut Diamond Trios on both sides, the lovely embellishments bring out a charming leaf motif in the sparkling ring. Accessorize with this gorgeous Ruby and Diamond Engagement Ring and add a touch of elegance to your outfit. Made from high-quality metal, the band is smooth and classy, letting the gemstones shine while keeping a balanced and refined look. This Lab Grown Ruby and Diamond Ring is a fantastic option for an engagement or a special promise, mixing classic style with modern craftsmanship. Its simple yet elegant design makes it perfect for everyday wear, and the AAAA quality lab created ruby ensures it always stands out. Every detail has been thoughtfully designed to make the Oval Engagement Ring both stunning and durable. Plus, using a lab-created ruby means it is an ethical and budget-friendly choice without losing any beauty or sparkle. Packaged in a lovely jewelry box, this Solitaire Ruby Ring is ready to make any proposal or special occasion unforgettable, symbolizing love, elegance, and careful design.

Product Information
SKU SHP-RINGS0821187868
Width 4.2 mm
Height 8 mm
Metal Weight 2.13 gm (Approximate)
Center Stone Weight 1.55 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 1.55 Carat (Approximate)
Dimension(approx) Oval-6X8 mm-1 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Claw-Set
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-4 Pcs
Marquise-2X4 mm-2 Pcs
Color HI
Cut Brilliant
Shape Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-rings