1.3 Carat Round London Blue Topaz Floral Engagement Ring with Diamond

0
Regular price $1,739
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


London Blue Topaz Floral Engagement Ring

This engagement ring features a striking round London Blue Topaz at its center, celebrated for its deep and captivating blue tone. The gemstone becomes the focal point of the design, offering a rich color that stands out while maintaining a refined elegance.

Diamond accents surround and complement the center stone, adding gentle brilliance that enhances the ring’s overall visual balance.

A Floral Inspired Ring Design

The ring’s floral motif introduces a delicate and decorative element that frames the center gemstone. Flower-inspired settings are widely appreciated in fine jewelry because they create a graceful structure that draws attention naturally toward the center stone.

This arrangement blends artistic design with classic gemstone placement, giving the ring a distinctive yet timeless presence.

The Beauty of London Blue Topaz

London Blue Topaz is admired for its deep blue color and elegant clarity. The round cut enhances the gemstone’s reflective qualities, allowing light to interact with the stone from multiple angles.

The result is a gemstone that offers a balance of color depth and brilliance, making it a popular choice for distinctive engagement jewelry.

A Meaningful Engagement Ring Style

Engagement rings often reflect both personal style and the significance of a shared milestone. Designs that combine colorful gemstones with refined metalwork offer an expressive alternative to traditional styles.

With its London Blue Topaz center stone, diamond accents, and floral-inspired design, this ring offers a graceful option for those who appreciate vibrant gemstone color and elegant detailing.

Product Information
SKU SHP-RINGS032221834
Metal Weight 3.40 gm (Approximate)
Center Stone Weight 1.35 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 1.35 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type 6-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-24 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 6-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-rings

FAQs About: 7mm Round London Blue Topaz Floral Engagement Ring with Diamond