0.7 Carat Oval Lab Grown Diamond Celtic Knot Engagement Ring

0
Sale price $408 Regular price $469
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Symbolic Design with Lasting Meaning

This oval lab grown diamond engagement ring is designed for those who value symbolism as much as aesthetics. The Celtic knot motif represents continuity and connection, making it a meaningful choice for marking commitment and shared journeys.

Its design offers more than visual appeal, bringing a sense of depth and intention to a classic engagement style.

Elegant Oval Center with Structured Detailing

The oval-shaped center stone provides a balanced, elongated appearance that enhances finger coverage while maintaining a refined profile. Paired with the intricate knot detailing, the ring achieves a harmony between softness and structure.

This contrast gives the piece a distinctive identity compared to traditional solitaire styles.

Celtic Knot Setting for Visual Depth

The interwoven design along the band adds dimension and character without overwhelming the central stone. It reflects careful craftsmanship, ensuring that each curve contributes to the overall symmetry of the ring.

This setting creates a layered look that remains elegant from every angle.

Lab Grown Diamond as a Modern Choice

Lab grown diamonds offer the same visual characteristics as traditionally sourced stones while being created without traditional mining. Their environmental impact varies by production and energy source.

This makes them a considered option for those seeking a contemporary approach to fine jewelry.

Designed for Daily Wear and Versatility

The ring is crafted to sit comfortably on the finger, allowing for consistent wear. Its design pairs well with a variety of wedding bands, especially those that complement or contrast the intricate knot detailing.

Whether worn alone or as part of a set, it maintains a refined and balanced appearance.

Product Information
SKU SHP-RINGS052410055
Width 2.8 mm
Height 8.2 mm
Weight 3.11 gm (Approximate)
Center Stone Weight 0.75 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.75 Carat (Approximate)
Dimension(approx) Oval-5X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Oval
Setting Type Bezel Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-grown-diamond-engagement-rings

Faq About: Oval Lab Grown Diamond Celtic Knot Engagement Ring

What does the Celtic knot design symbolize?
The Celtic knot represents continuity and an unbroken bond, making it a meaningful choice for engagement rings.
Is an oval diamond a good choice for engagement rings?
Oval diamonds are popular for their elongated shape, which offers a balanced look and enhances visual presence on the finger.
Can this ring be worn every day?
The design is suitable for regular wear when handled with care, making it practical for daily use.
Will this ring pair well with a wedding band?
Yes, it can be paired with a variety of bands, including simple or contoured styles that complement its detailed design.
What makes lab grown diamonds different?
Lab grown diamonds are created without traditional mining and offer similar visual properties, though their impact depends on production methods.
Is this ring suitable as a unique engagement ring?
The combination of an oval center stone and Celtic knot detailing makes it a distinctive option for those seeking something beyond a classic solitaire.