0.25 Carat Round Cut Solitaire Ruby Heart Pendant Necklace

0
Sale price $1,582 Regular price $1,739
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Our exquisite Ruby Pendant Necklace is a dazzling piece of jewelry designed to add a touch of elegance to your everyday look. Adorned with a brilliant 4 MM Round Shaped Ruby set delicately in Prong Setting in the center of an open heart motif, this stunning Solitaire Pendant exudes timeless charm. This radiant Heart Locket Necklace creates a captivating sparkle at your neckline. With its versatile appeal, this Red Heart Necklace crafted with metal, offers the perfect piece for every woman, catering to individual styles and preferences. Whether you appreciate the understated beauty of minimalist jewelry or desire to infuse romance into your ensemble, the Classic Necklace is the ideal choice. Beyond its striking look, this Heart Pendant Necklace is believed to add love and romance to your life, adding a layer of meaning and comfort. It comes ready to gift, hanging from a delicate cable chain which is completely optional, and packaged in a beautiful jewelry box, making it an easy and thoughtful gift choice.

Product Information
SKU SHP-PENDANT012012090
Length 18 mm
Width 13 mm
Metal Weight 4.90 gm (Approximate)
Total Stone Weight 0.26 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
ruby-necklace